Lineage for d2nqpd1 (2nqp D:8-270)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052430Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 1052431Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 1052432Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)
  6. 1052433Protein Pseudouridine synthase I TruA [55122] (1 species)
  7. 1052434Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)
  8. 1052440Domain d2nqpd1: 2nqp D:8-270 [138477]
    automatically matched to d1dj0a_
    protein/RNA complex; complexed with k

Details for d2nqpd1

PDB Entry: 2nqp (more details), 3.5 Å

PDB Description: Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA
PDB Compounds: (D:) tRNA pseudouridine synthase A

SCOPe Domain Sequences for d2nqpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqpd1 d.265.1.1 (D:8-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
pvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgtg
qvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhrl
rpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrhg
pyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaeglyl
vavdypdrydlpkppmgplflad

SCOPe Domain Coordinates for d2nqpd1:

Click to download the PDB-style file with coordinates for d2nqpd1.
(The format of our PDB-style files is described here.)

Timeline for d2nqpd1: