SCOP 1.73: Domain d2nqpd1: 2nqp D:8-270

Lineage for d2nqpd1 (2nqp D:8-270)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (4 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)

6. Protein Pseudouridine synthase I TruA [55122] (1 species)

7. Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)

8. Domain d2nqpd1: 2nqp D:8-270 [138477]
   automatically matched to d1dj0a_
   complexed with k

Details for d2nqpd1

PDB Entry: 2nqp, 3.5 Å

PDB Description: Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA

PDB Compounds: (D:) tRNA pseudouridine synthase A

SCOP Domain Sequences for d2nqpd1:

Sequence; same for both SEQRES and ATOM records:

>d2nqpd1 d.265.1.1 (D:8-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
pvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgtg
qvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhrl
rpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrhg
pyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaeglyl
vavdypdrydlpkppmgplflad

Timeline for d2nqpd1:

• d2nqpd1 is new in SCOP 1.73
  
• d2nqpd1 appears in SCOP 1.75
  
• d2nqpd1 appears in the current release, SCOPe 2.08