![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.265: Pseudouridine synthase [100877] (1 superfamily) consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold |
![]() | Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) ![]() the active site is the most conserved structural region of the superfamily and is located between the subdomains |
![]() | Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein) |
![]() | Protein Pseudouridine synthase I TruA [55122] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [55123] (4 PDB entries) |
![]() | Domain d2nqpc1: 2nqp C:7-270 [138476] automatically matched to d1dj0a_ protein/RNA complex; complexed with k |
PDB Entry: 2nqp (more details), 3.5 Å
SCOPe Domain Sequences for d2nqpc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqpc1 d.265.1.1 (C:7-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]} ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly lvavdypdrydlpkppmgplflad
Timeline for d2nqpc1: