Lineage for d2nqpc1 (2nqp C:7-270)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741101Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 741102Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 741103Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)
  6. 741104Protein Pseudouridine synthase I TruA [55122] (1 species)
  7. 741105Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)
  8. 741110Domain d2nqpc1: 2nqp C:7-270 [138476]
    automatically matched to d1dj0a_
    complexed with k

Details for d2nqpc1

PDB Entry: 2nqp (more details), 3.5 Å

PDB Description: Crystal structure of pseudoudirinde synthase TruA in complex with leucyl tRNA
PDB Compounds: (C:) tRNA pseudouridine synthase A

SCOP Domain Sequences for d2nqpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqpc1 d.265.1.1 (C:7-270) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

SCOP Domain Coordinates for d2nqpc1:

Click to download the PDB-style file with coordinates for d2nqpc1.
(The format of our PDB-style files is described here.)

Timeline for d2nqpc1: