Lineage for d2nqna3 (2nqn A:178-326)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 703405Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 703406Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 703471Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
  6. 703479Protein MoeA, central domain [64104] (4 species)
  7. 703482Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)
  8. 703487Domain d2nqna3: 2nqn A:178-326 [138469]
    Other proteins in same PDB: d2nqna1, d2nqna2, d2nqnb1, d2nqnb2
    automatically matched to d1fc5a3
    complexed with gol; mutant

Details for d2nqna3

PDB Entry: 2nqn (more details), 2.2 Å

PDB Description: moea t100w
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nqna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqna3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

SCOP Domain Coordinates for d2nqna3:

Click to download the PDB-style file with coordinates for d2nqna3.
(The format of our PDB-style files is described here.)

Timeline for d2nqna3: