| Class b: All beta proteins [48724] (165 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) ![]() |
| Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
| Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
| Species Escherichia coli [TaxId:562] [63870] (14 PDB entries) |
| Domain d2nqna1: 2nqn A:327-409 [138467] Other proteins in same PDB: d2nqna2, d2nqna3, d2nqnb2, d2nqnb3 automatically matched to d1g8la1 complexed with gol; mutant |
PDB Entry: 2nqn (more details), 2.2 Å
SCOP Domain Sequences for d2nqna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nqna1 b.85.6.1 (A:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg
Timeline for d2nqna1: