Lineage for d2nqmb2 (2nqm B:7-177)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1140866Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 1140867Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
  5. 1140868Family b.103.1.1: MoeA N-terminal region -like [63883] (2 proteins)
  6. 1140876Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 1140877Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. 1140907Domain d2nqmb2: 2nqm B:7-177 [138465]
    Other proteins in same PDB: d2nqma1, d2nqma3, d2nqmb1, d2nqmb3
    automatically matched to d1fc5a2
    mutant

Details for d2nqmb2

PDB Entry: 2nqm (more details), 3 Å

PDB Description: moea t100a mutant
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqmb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla
diasgqplpvagksfagqpyhgewpagtcirimagapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOPe Domain Coordinates for d2nqmb2:

Click to download the PDB-style file with coordinates for d2nqmb2.
(The format of our PDB-style files is described here.)

Timeline for d2nqmb2: