Lineage for d2nqmb1 (2nqm B:327-409)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678607Superfamily b.85.6: MoeA C-terminal domain-like [63867] (1 family) (S)
  5. 678608Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 678616Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 678619Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 678649Domain d2nqmb1: 2nqm B:327-409 [138464]
    Other proteins in same PDB: d2nqma2, d2nqma3, d2nqmb2, d2nqmb3
    automatically matched to d1g8la1
    mutant

Details for d2nqmb1

PDB Entry: 2nqm (more details), 3 Å

PDB Description: moea t100a mutant
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nqmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqmb1 b.85.6.1 (B:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

SCOP Domain Coordinates for d2nqmb1:

Click to download the PDB-style file with coordinates for d2nqmb1.
(The format of our PDB-style files is described here.)

Timeline for d2nqmb1: