![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
![]() | Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) ![]() automatically mapped to Pfam PF03453 |
![]() | Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [63885] (14 PDB entries) |
![]() | Domain d2nqma2: 2nqm A:7-177 [138462] Other proteins in same PDB: d2nqma1, d2nqma3, d2nqmb1, d2nqmb3 mutant fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2nqm (more details), 3 Å
SCOPe Domain Sequences for d2nqma2:
Sequence, based on SEQRES records: (download)
>d2nqma2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamdgyavrla diasgqplpvagksfagqpyhgewpagtcirimagapvpegceavvmqeqteqmdngvrf taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk
>d2nqma2 b.103.1.1 (A:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]} lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnrrrgedisaga vvfpagtrlttaelpviaslgiaevpvirk
Timeline for d2nqma2: