Lineage for d2nqkb3 (2nqk B:178-326)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838437Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 838438Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 838503Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
  6. 838511Protein MoeA, central domain [64104] (4 species)
  7. 838514Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)
  8. 838536Domain d2nqkb3: 2nqk B:178-326 [138460]
    Other proteins in same PDB: d2nqka1, d2nqka2, d2nqkb1, d2nqkb2
    automatically matched to d1fc5a3
    mutant

Details for d2nqkb3

PDB Entry: 2nqk (more details), 2.9 Å

PDB Description: moea d59n mutant
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOP Domain Sequences for d2nqkb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqkb3 c.57.1.2 (B:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

SCOP Domain Coordinates for d2nqkb3:

Click to download the PDB-style file with coordinates for d2nqkb3.
(The format of our PDB-style files is described here.)

Timeline for d2nqkb3: