Lineage for d2nqkb2 (2nqk B:7-177)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. Species Escherichia coli [TaxId:562] [63885] (14 PDB entries)
  8. Domain d2nqkb2: 2nqk B:7-177 [138459]
    Other proteins in same PDB: d2nqka1, d2nqka3, d2nqkb1, d2nqkb3
    automated match to d1g8la2
    mutant

Details for d2nqkb2

PDB Entry: 2nqk (more details), 2.9 Å

PDB Description: MoeA D59N mutant
PDB Compounds: (B:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqkb2 b.103.1.1 (B:7-177) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Escherichia coli [TaxId: 562]}
lmsldtalnemlsrvtpltaqetlplvqcfgrilasdvvspldvpgfdnsamngyavrla
diasgqplpvagksfagqpyhgewpagtcirimtgapvpegceavvmqeqteqmdngvrf
taevrsgqnirrrgedisagavvfpagtrlttaelpviaslgiaevpvirk

SCOPe Domain Coordinates for d2nqkb2 are not available.

Timeline for d2nqkb2:

Domains from same chain:
(mouse over for more information)
d2nqkb1, d2nqkb3
Domains from other chains:
(mouse over for more information)
d2nqka1, d2nqka2, d2nqka3