SCOPe 2.08: Domain d2nqka3: 2nqk A:178-326

Lineage for d2nqka3 (2nqk A:178-326)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
   automatically mapped to Pfam PF00994

6. Protein MoeA, central domain [64104] (4 species)

7. Species Escherichia coli [TaxId:562] [64105] (14 PDB entries)

8. Domain d2nqka3: 2nqk A:178-326 [138457]
   Other proteins in same PDB: d2nqka1, d2nqka2, d2nqkb1, d2nqkb2
   automated match to d2nqra3
   mutant

Details for d2nqka3

PDB Entry: 2nqk, 2.9 Å

PDB Description: moea d59n mutant

PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqka3:

Sequence; same for both SEQRES and ATOM records:

>d2nqka3 c.57.1.2 (A:178-326) MoeA, central domain {Escherichia coli [TaxId: 562]}
vrvalfstgdelqlpgqplgdgqiydtnrlavhlmleqlgcevinlgiirddphalraaf
ieadsqadvvissggvsvgeadytktileelgeiafwklaikpgkpfafgklsnswfcgl
pgnpvsatltfyqlvqpllaklsgntasg

Timeline for d2nqka3:

• d2nqka3 first appeared in SCOP 1.73
  
• d2nqka3 appears in SCOPe 2.07