Lineage for d2nqka1 (2nqk A:327-409)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083737Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2083738Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 2083746Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 2083747Species Escherichia coli [TaxId:562] [63870] (14 PDB entries)
  8. 2083768Domain d2nqka1: 2nqk A:327-409 [138455]
    Other proteins in same PDB: d2nqka2, d2nqka3, d2nqkb2, d2nqkb3
    automated match to d2nqra1
    mutant

Details for d2nqka1

PDB Entry: 2nqk (more details), 2.9 Å

PDB Description: moea d59n mutant
PDB Compounds: (A:) Molybdopterin biosynthesis protein moeA

SCOPe Domain Sequences for d2nqka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nqka1 b.85.6.1 (A:327-409) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Escherichia coli [TaxId: 562]}
lparqrvrtasrlkktpgrldfqrgvlqrnadgelevtttghqgshifssfslgncfivl
erdrgnvevgewvevepfnalfg

SCOPe Domain Coordinates for d2nqka1:

Click to download the PDB-style file with coordinates for d2nqka1.
(The format of our PDB-style files is described here.)

Timeline for d2nqka1: