Lineage for d2nq3a1 (2nq3 A:13-145)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772810Protein E3 ubiquitin-protein ligase Itchy [141103] (1 species)
  7. 2772811Species Human (Homo sapiens) [TaxId:9606] [141104] (1 PDB entry)
    Uniprot Q96J02 13-145
  8. 2772812Domain d2nq3a1: 2nq3 A:13-145 [138452]
    complexed with cl
    has additional insertions and/or extensions that are not grouped together

Details for d2nq3a1

PDB Entry: 2nq3 (more details), 1.8 Å

PDB Description: Crystal structure of the C2 Domain of Human Itchy Homolog E3 Ubiquitin Protein Ligase
PDB Compounds: (A:) Itchy homolog E3 ubiquitin protein ligase

SCOPe Domain Sequences for d2nq3a1:

Sequence, based on SEQRES records: (download)

>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]}
sltmksqlqitvisaklkenkknwfgpspyvevtvdgqskktekcnntnspkwkqpltvi
vtpvsklhfrvwshqtlksdvllgtaaldiyetlksnnmkleevvvtlqlggdkepteti
gdlsicldglqle

Sequence, based on observed residues (ATOM records): (download)

>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]}
sltmksqlqitvisaklkenkwfgpspyvevtvdgqskktekcnntnspkwkqpltvivt
pvsklhfrvwshqtlksdvllgtaaldiyetlksnnmkleevvvtlqlggdkeptetigd
lsicldglqle

SCOPe Domain Coordinates for d2nq3a1:

Click to download the PDB-style file with coordinates for d2nq3a1.
(The format of our PDB-style files is described here.)

Timeline for d2nq3a1: