![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
![]() | Protein E3 ubiquitin-protein ligase Itchy [141103] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141104] (1 PDB entry) Uniprot Q96J02 13-145 |
![]() | Domain d2nq3a1: 2nq3 A:13-145 [138452] complexed with cl has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2nq3 (more details), 1.8 Å
SCOPe Domain Sequences for d2nq3a1:
Sequence, based on SEQRES records: (download)
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} sltmksqlqitvisaklkenkknwfgpspyvevtvdgqskktekcnntnspkwkqpltvi vtpvsklhfrvwshqtlksdvllgtaaldiyetlksnnmkleevvvtlqlggdkepteti gdlsicldglqle
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} sltmksqlqitvisaklkenkwfgpspyvevtvdgqskktekcnntnspkwkqpltvivt pvsklhfrvwshqtlksdvllgtaaldiyetlksnnmkleevvvtlqlggdkeptetigd lsicldglqle
Timeline for d2nq3a1: