SCOP 1.73: Domain d2nptd1: 2npt D:42-122

Lineage for d2nptd1 (2npt D:42-122)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (10 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries)

8. Domain d2nptd1: 2npt D:42-122 [138451]
   Other proteins in same PDB: d2npta1, d2nptc1
   automatically matched to 2NPT B:42-123

Details for d2nptd1

PDB Entry: 2npt, 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)

PDB Compounds: (D:) Mitogen-activated protein kinase kinase kinase 2

SCOP Domain Sequences for d2nptd1:

Sequence; same for both SEQRES and ATOM records:

>d2nptd1 d.15.2.2 (D:42-122) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]}
ndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplttqddldk
avelldrsihmkslkillvin

Timeline for d2nptd1:

• d2nptd1 is new in SCOP 1.73
  
• d2nptd1 appears in SCOP 1.75
  
• d2nptd1 appears in the current release, SCOPe 2.08, called d2nptd_