Lineage for d2nptd_ (2npt D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933622Family d.15.2.2: PB1 domain [64225] (11 proteins)
    Pfam PF00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 2933639Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species)
  7. 2933640Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries)
    Uniprot Q9Y2U5 42-123! Uniprot Q9Y2U5 43-132
  8. 2933642Domain d2nptd_: 2npt D: [138451]
    Other proteins in same PDB: d2npta1, d2npta2, d2nptc2, d2nptc3
    automated match to d2nptb1

Details for d2nptd_

PDB Entry: 2npt (more details), 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)
PDB Compounds: (D:) Mitogen-activated protein kinase kinase kinase 2

SCOPe Domain Sequences for d2nptd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nptd_ d.15.2.2 (D:) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]}
ssspkkqndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplt
tqddldkavelldrsihmkslkillvin

SCOPe Domain Coordinates for d2nptd_:

Click to download the PDB-style file with coordinates for d2nptd_.
(The format of our PDB-style files is described here.)

Timeline for d2nptd_: