![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
![]() | Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries) Uniprot Q9Y2U5 42-123! Uniprot Q9Y2U5 43-132 |
![]() | Domain d2nptd_: 2npt D: [138451] Other proteins in same PDB: d2npta1, d2npta2, d2nptc2, d2nptc3 automated match to d2nptb1 |
PDB Entry: 2npt (more details), 1.75 Å
SCOPe Domain Sequences for d2nptd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nptd_ d.15.2.2 (D:) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]} ssspkkqndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplt tqddldkavelldrsihmkslkillvin
Timeline for d2nptd_: