SCOPe 2.08: Domain d2nptb1: 2npt B:42-123

Lineage for d2nptb1 (2npt B:42-123)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (11 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Mitogen-activated protein kinase kinase kinase 2, MEKK 2 [142976] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142977] (2 PDB entries)
   Uniprot Q9Y2U5 42-123! Uniprot Q9Y2U5 43-132

8. Domain d2nptb1: 2npt B:42-123 [138449]
   Other proteins in same PDB: d2npta1, d2npta2, d2nptc2, d2nptc3

Details for d2nptb1

PDB Entry: 2npt, 1.75 Å

PDB Description: Crystal Structure of the complex of human mitogen activated protein kinase kinase 5 phox domain (MAP2K5-phox) with human mitogen activated protein kinase kinase kinase 2 phox domain (MAP3K2-phox)

PDB Compounds: (B:) Mitogen-activated protein kinase kinase kinase 2

SCOPe Domain Sequences for d2nptb1:

Sequence; same for both SEQRES and ATOM records:

>d2nptb1 d.15.2.2 (B:42-123) Mitogen-activated protein kinase kinase kinase 2, MEKK 2 {Human (Homo sapiens) [TaxId: 9606]}
ndvrvkfehrgekrilqfprpvkledlrskakiafgqsmdlhytnnelviplttqddldk
avelldrsihmkslkillving

Timeline for d2nptb1:

• d2nptb1 first appeared in SCOP 1.73
  
• d2nptb1 appears in SCOPe 2.07