Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
Protein Mitogen activated protein kinase kinase 5, Map2k5 [117827] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [142975] (2 PDB entries) Uniprot Q13163 4-108 |
Domain d2npta1: 2npt A:5-108 [138448] Other proteins in same PDB: d2npta2, d2nptb1, d2nptc3, d2nptd_ |
PDB Entry: 2npt (more details), 1.75 Å
SCOPe Domain Sequences for d2npta1:
Sequence, based on SEQRES records: (download)
>d2npta1 d.15.2.2 (A:5-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]} algpfpamenqvlvirikipnsgavdwtvhsgpqllfrdvldvigqvlpeatttafeyed edgdritvrsdeemkamlsyyystvmeqqvngqlieplqifpra
>d2npta1 d.15.2.2 (A:5-108) Mitogen activated protein kinase kinase 5, Map2k5 {Human (Homo sapiens) [TaxId: 9606]} algpfpamqvlvirikipnsgavdwtvhsqllfrdvldvigqvlpeatttafeyededgd ritvrsdeemkamlsyyystvmeqqvngqlieplqifpra
Timeline for d2npta1:
View in 3D Domains from other chains: (mouse over for more information) d2nptb1, d2nptc2, d2nptc3, d2nptd_ |