SCOPe 2.07: Domain d2nppb1: 2npp B:28-415

Lineage for d2nppb1 (2npp B:28-415)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.20: B56-like [140819] (1 protein)
   Pfam PF01603; Protein phosphatase 2A regulatory B subunit family

6. Protein Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma [140820] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140821] (6 PDB entries)
   Uniprot Q13362 30-372! Uniprot Q13362 38-425

8. Domain d2nppb1: 2npp B:28-415 [138445]
   Other proteins in same PDB: d2nppa1, d2nppc1, d2nppd1, d2nppf1
   complexed with mn

Details for d2nppb1

PDB Entry: 2npp, 3.3 Å

PDB Description: Structure of the Protein Phosphatase 2A Holoenzyme

PDB Compounds: (B:) serine/threonine-protein phosphatase 2a 56 kda regulatory subunit gamma isoform

SCOPe Domain Sequences for d2nppb1:

Sequence; same for both SEQRES and ATOM records:

>d2nppb1 a.118.1.20 (B:28-415) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]}
qeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvitepiypevvh
mfavnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrflespdfqpniakk
yidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqinnifyrfiyeteh
hngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlaycvvqflek
dstltepvvmallkywpkthspkevmflneleeildviepsefvkimeplfrqlakcvss
phfqvaeralyywnneyimslisdnaakilpimfpslyrnskthwnktihgliynalklf
memnqklfddctqqfkaeklkeklkmke

Timeline for d2nppb1:

• d2nppb1 first appeared in SCOP 1.73
  
• d2nppb1 appears in SCOPe 2.06
  
• d2nppb1 appears in the current release, SCOPe 2.08