Lineage for d2npfb5 (2npf B:726-842)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862792Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) (S)
  5. 862793Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 862794Protein Elongation factor 2 (eEF-2) [82677] (1 species)
  7. 862795Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (13 PDB entries)
    Uniprot P32324
  8. 862807Domain d2npfb5: 2npf B:726-842 [138441]
    Other proteins in same PDB: d2npfa1, d2npfa2, d2npfa3, d2npfb1, d2npfb2, d2npfb3
    automatically matched to d1n0ua5
    complexed with gdp, mou

Details for d2npfb5

PDB Entry: 2npf (more details), 2.9 Å

PDB Description: structure of eef2 in complex with moriniafungin
PDB Compounds: (B:) Elongation factor 2

SCOP Domain Sequences for d2npfb5:

Sequence, based on SEQRES records: (download)

>d2npfb5 d.58.11.1 (B:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelr
qatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

Sequence, based on observed residues (ATOM records): (download)

>d2npfb5 d.58.11.1 (B:726-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epvflveiqcpeqavggiysvlnkkrgqvvseeqplftvkaylpvnesfgftgelrqatg
gqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl

SCOP Domain Coordinates for d2npfb5:

Click to download the PDB-style file with coordinates for d2npfb5.
(The format of our PDB-style files is described here.)

Timeline for d2npfb5: