Lineage for d2npfb4 (2npf B:482-560)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953474Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) (S)
  5. 2953475Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins)
    domain III structure is lacking some of the superfamily characters and is often disordered in crystals
  6. 2953505Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species)
  7. 2953506Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419527] (13 PDB entries)
    Uniprot P32324
  8. 2953527Domain d2npfb4: 2npf B:482-560 [138440]
    Other proteins in same PDB: d2npfa1, d2npfa2, d2npfa3, d2npfa5, d2npfb1, d2npfb2, d2npfb3, d2npfb5
    automated match to d1n0ua4
    complexed with gdp, mou

Details for d2npfb4

PDB Entry: 2npf (more details), 2.9 Å

PDB Description: structure of eef2 in complex with moriniafungin
PDB Compounds: (B:) Elongation factor 2

SCOPe Domain Sequences for d2npfb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2npfb4 d.58.11.1 (B:482-560) Elongation factor 2 (eEF-2), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv

SCOPe Domain Coordinates for d2npfb4:

Click to download the PDB-style file with coordinates for d2npfb4.
(The format of our PDB-style files is described here.)

Timeline for d2npfb4: