| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families) ![]() |
| Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (5 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
| Protein Elongation factor 2 (eEF-2), N-terminal domain [419042] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419527] (13 PDB entries) Uniprot P32324 |
| Domain d2npfa4: 2npf A:482-560 [138435] Other proteins in same PDB: d2npfa1, d2npfa2, d2npfa3, d2npfa5, d2npfb1, d2npfb2, d2npfb3, d2npfb5 automated match to d1n0ua4 complexed with gdp, mou |
PDB Entry: 2npf (more details), 2.9 Å
SCOPe Domain Sequences for d2npfa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2npfa4 d.58.11.1 (A:482-560) Elongation factor 2 (eEF-2), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhleic
lqdlehdhagvplkisppv
Timeline for d2npfa4: