Lineage for d2np5d2 (2np5 D:78-192)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647677Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 647678Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 647679Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins)
  6. 647833Protein Transcriptional regulator RHA1_ro04179 [140905] (1 species)
  7. 647834Species Rhodococcus sp. [TaxId:1831] [140906] (1 PDB entry)
  8. 647838Domain d2np5d2: 2np5 D:78-192 [138431]
    Other proteins in same PDB: d2np5a1, d2np5b1, d2np5c1, d2np5d1
    automatically matched to 2NP5 A:78-195
    complexed with lmt, nds

Details for d2np5d2

PDB Entry: 2np5 (more details), 1.8 Å

PDB Description: crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1.
PDB Compounds: (D:) Transcriptional regulator

SCOP Domain Sequences for d2np5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2np5d2 a.121.1.1 (D:78-192) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]}
ggdparalfaamsqllpldearsreahvmaafavraatspslaeirrktlftirtglsav
ligigtpeaetraalllatvdglaldaigspalyppeylehaldiqigmilqgad

SCOP Domain Coordinates for d2np5d2:

Click to download the PDB-style file with coordinates for d2np5d2.
(The format of our PDB-style files is described here.)

Timeline for d2np5d2: