Lineage for d2np5d1 (2np5 D:10-77)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634287Superfamily a.4.1: Homeodomain-like [46689] (17 families) (S)
    consists only of helices
  5. 634637Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (28 proteins)
  6. 634791Protein Transcriptional regulator RHA1_ro04179 [140189] (1 species)
  7. 634792Species Rhodococcus sp. [TaxId:1831] [140190] (1 PDB entry)
  8. 634796Domain d2np5d1: 2np5 D:10-77 [138430]
    Other proteins in same PDB: d2np5a2, d2np5b2, d2np5c2, d2np5d2
    automatically matched to 2NP5 A:9-77
    complexed with lmt, nds

Details for d2np5d1

PDB Entry: 2np5 (more details), 1.8 Å

PDB Description: crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1.
PDB Compounds: (D:) Transcriptional regulator

SCOP Domain Sequences for d2np5d1:

Sequence, based on SEQRES records: (download)

>d2np5d1 a.4.1.9 (D:10-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]}
sperlaaalfdvaaesglegasvrevakragvsigavqhhfstkdemfafalrtlvdkll
arlsever

Sequence, based on observed residues (ATOM records): (download)

>d2np5d1 a.4.1.9 (D:10-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]}
sperlaaalfdvaaesglkdemfafalrtlvdkllarlsever

SCOP Domain Coordinates for d2np5d1:

Click to download the PDB-style file with coordinates for d2np5d1.
(The format of our PDB-style files is described here.)

Timeline for d2np5d1: