![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins) |
![]() | Protein Transcriptional regulator RHA1_ro04179 [140905] (1 species) |
![]() | Species Rhodococcus sp. [TaxId:1831] [140906] (1 PDB entry) |
![]() | Domain d2np5c2: 2np5 C:78-193 [138429] Other proteins in same PDB: d2np5a1, d2np5b1, d2np5c1, d2np5d1 automatically matched to 2NP5 A:78-195 complexed with lmt, nds |
PDB Entry: 2np5 (more details), 1.8 Å
SCOP Domain Sequences for d2np5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2np5c2 a.121.1.1 (C:78-193) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} ggdparalfaamsqllpldearsreahvmaafavraatspslaeirrktlftirtglsav ligigtpeaetraalllatvdglaldaigspalyppeylehaldiqigmilqgadv
Timeline for d2np5c2: