SCOP 1.75: Domain d2np5c1: 2np5 C:10-77

Lineage for d2np5c1 (2np5 C:10-77)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (19 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Transcriptional regulator RHA1_ro04179 [140189] (1 species)

7. Species Rhodococcus sp. [TaxId:1831] [140190] (1 PDB entry)
   Uniprot Q0S914 9-77

8. Domain d2np5c1: 2np5 C:10-77 [138428]
   Other proteins in same PDB: d2np5a2, d2np5b2, d2np5c2, d2np5d2
   automatically matched to 2NP5 A:9-77
   complexed with lmt, nds

Details for d2np5c1

PDB Entry: 2np5, 1.8 Å

PDB Description: crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1.

PDB Compounds: (C:) Transcriptional regulator

SCOP Domain Sequences for d2np5c1:

Sequence; same for both SEQRES and ATOM records:

>d2np5c1 a.4.1.9 (C:10-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]}
sperlaaalfdvaaesglegasvrevakragvsigavqhhfstkdemfafalrtlvdkll
arlsever

Timeline for d2np5c1:

• d2np5c1 first appeared in SCOP 1.73
  
• d2np5c1 appears in SCOPe 2.01
  
• d2np5c1 appears in the current release, SCOPe 2.08