![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Transcriptional regulator RHA1_ro04179 [140189] (1 species) |
![]() | Species Rhodococcus sp. [TaxId:1831] [140190] (1 PDB entry) Uniprot Q0S914 9-77 |
![]() | Domain d2np5b1: 2np5 B:9-77 [138426] Other proteins in same PDB: d2np5a2, d2np5b2, d2np5c2, d2np5d2 automated match to d2np5a1 complexed with lmt, nds |
PDB Entry: 2np5 (more details), 1.8 Å
SCOPe Domain Sequences for d2np5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2np5b1 a.4.1.9 (B:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]} tsperlaaalfdvaaesglegasvrevakragvsigavqhhfstkdemfafalrtlvdkl larlsever
Timeline for d2np5b1: