SCOPe 2.07: Domain d2np5a1: 2np5 A:9-77

Lineage for d2np5a1 (2np5 A:9-77)

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (20 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
Protein Transcriptional regulator RHA1_ro04179 [140189] (1 species)
Species Rhodococcus sp. [TaxId:1831] [140190] (1 PDB entry)
Uniprot Q0S914 9-77
Domain d2np5a1: 2np5 A:9-77 [138424]
Other proteins in same PDB: d2np5a2, d2np5b2, d2np5c2, d2np5d2
complexed with lmt, nds

Details for d2np5a1

PDB Entry: 2np5 (more details), 1.8 Å

PDB Description: crystal structure of a transcriptional regulator (rha1_ro04179) from rhodococcus sp. rha1.

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2np5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]}
tsperlaaalfdvaaesglegasvrevakragvsigavqhhfstkdemfafalrtlvdkl
larlsever

SCOPe Domain Coordinates for d2np5a1:

Click to download the PDB-style file with coordinates for d2np5a1.
(The format of our PDB-style files is described here.)

Timeline for d2np5a1: