Lineage for d2np3b1 (2np3 B:22-99)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305865Protein Putative transcriptional regulator SCO0857 [140207] (1 species)
  7. 2305866Species Streptomyces coelicolor [TaxId:1902] [140208] (1 PDB entry)
    Uniprot Q9RCV4 35-99
  8. 2305868Domain d2np3b1: 2np3 B:22-99 [138422]
    Other proteins in same PDB: d2np3a2, d2np3b2
    automated match to d2np3a1

Details for d2np3b1

PDB Entry: 2np3 (more details), 2.35 Å

PDB Description: crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3.
PDB Compounds: (B:) Putative TetR-family regulator

SCOPe Domain Sequences for d2np3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2np3b1 a.4.1.9 (B:22-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]}
ggrrpgetrtreailtaarvcfaergfdatslrriaetagvdqslvhhfygtkenlflqa
lelpgkieeaitaaaqgg

SCOPe Domain Coordinates for d2np3b1:

Click to download the PDB-style file with coordinates for d2np3b1.
(The format of our PDB-style files is described here.)

Timeline for d2np3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2np3b2