SCOPe 2.07: Domain d2np0a2: 2np0 A:1080-1290

Lineage for d2np0a2 (2np0 A:1080-1290)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein Botulinum neurotoxin [50402] (2 species)

7. Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (14 PDB entries)

8. Domain d2np0a2: 2np0 A:1080-1290 [138417]
   Other proteins in same PDB: d2np0a1, d2np0a3, d2np0a4
   automated match to d1epwa2
   complexed with ca, cl, zn

Details for d2np0a2

PDB Entry: 2np0, 2.62 Å

PDB Description: Crystal structure of the Botulinum neurotoxin type B complexed with synaptotagamin-II ectodomain

PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d2np0a2:

Sequence; same for both SEQRES and ATOM records:

>d2np0a2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

Timeline for d2np0a2:

• d2np0a2 first appeared in SCOP 1.73
  
• d2np0a2 appears in SCOPe 2.06
  
• d2np0a2 appears in the current release, SCOPe 2.08