Lineage for d2np0a1 (2np0 A:862-1079)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
    automatically mapped to Pfam PF07953
  6. Protein Botulinum neurotoxin [49959] (2 species)
  7. Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (14 PDB entries)
  8. Domain d2np0a1: 2np0 A:862-1079 [138416]
    Other proteins in same PDB: d2np0a2, d2np0a3, d2np0a4
    automated match to d1epwa1
    complexed with ca, cl, zn

Details for d2np0a1

PDB Entry: 2np0 (more details), 2.62 Å

PDB Description: Crystal structure of the Botulinum neurotoxin type B complexed with synaptotagamin-II ectodomain
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d2np0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2np0a1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

SCOPe Domain Coordinates for d2np0a1 are not available.

Timeline for d2np0a1:

Domains from same chain:
(mouse over for more information)
d2np0a2, d2np0a3, d2np0a4