Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) |
Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins) contains a single copy of this fold |
Protein 8-oxoguanine glycosylase [55955] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries) |
Domain d2noza2: 2noz A:12-135 [138415] Other proteins in same PDB: d2noza1, d2noza3 automated match to d1m3qa2 protein/DNA complex; complexed with ca |
PDB Entry: 2noz (more details), 2.43 Å
SCOPe Domain Sequences for d2noza2:
Sequence, based on SEQRES records: (download)
>d2noza2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr llrq
>d2noza2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr q
Timeline for d2noza2: