SCOPe 2.07: Domain d2noza1: 2noz A:136-323

Lineage for d2noza1 (2noz A:136-323)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)

8. Domain d2noza1: 2noz A:136-323 [138414]
   Other proteins in same PDB: d2noza2, d2noza3
   automated match to d1ebma1
   protein/DNA complex; complexed with ca

Details for d2noza1

PDB Entry: 2noz, 2.43 Å

PDB Description: structure of q315f human 8-oxoguanine glycosylase distal crosslink to 8-oxoguanine dna

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2noza1:

Sequence, based on SEQRES records:

>d2noza1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpcpqtnkelgnffrslwgpyagwaf
avlfsadl

Sequence, based on observed residues (ATOM records):

>d2noza1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttakgpcpqtnkelgnffrslwgpyagwafav
lfsadl

Timeline for d2noza1:

• d2noza1 first appeared in SCOP 1.73
  
• d2noza1 appears in SCOPe 2.06
  
• d2noza1 appears in the current release, SCOPe 2.08