Lineage for d2noza1 (2noz A:136-323)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645404Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 645405Superfamily a.96.1: DNA-glycosylase [48150] (6 families) (S)
  5. 645439Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (2 proteins)
  6. 645448Protein 8-oxoguanine glycosylase [48160] (1 species)
  7. 645449Species Human (Homo sapiens) [TaxId:9606] [48161] (23 PDB entries)
  8. 645467Domain d2noza1: 2noz A:136-323 [138414]
    Other proteins in same PDB: d2noza2
    automatically matched to d1ebma1
    complexed with 8og, ca; mutant

Details for d2noza1

PDB Entry: 2noz (more details), 2.43 Å

PDB Description: structure of q315f human 8-oxoguanine glycosylase distal crosslink to 8-oxoguanine dna
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOP Domain Sequences for d2noza1:

Sequence, based on SEQRES records: (download)

>d2noza1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpcpqtnkelgnffrslwgpyagwaf
avlfsadl

Sequence, based on observed residues (ATOM records): (download)

>d2noza1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttakgpcpqtnkelgnffrslwgpyagwafav
lfsadl

SCOP Domain Coordinates for d2noza1:

Click to download the PDB-style file with coordinates for d2noza1.
(The format of our PDB-style files is described here.)

Timeline for d2noza1: