SCOPe 2.05: Domain d2nola1: 2nol A:136-325

Lineage for d2nola1 (2nol A:136-325)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein 8-oxoguanine glycosylase [48160] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)

8. Domain d2nola1: 2nol A:136-325 [138411]
   Other proteins in same PDB: d2nola2
   automated match to d1ebma1
   protein/DNA complex; complexed with ca

Details for d2nola1

PDB Entry: 2nol, 2.57 Å

PDB Description: structure of catalytically inactive human 8-oxoguanine glycosylase distal crosslink to oxog dna

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2nola1:

Sequence; same for both SEQRES and ATOM records:

>d2nola1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtqvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpcpqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d2nola1:

• d2nola1 first appeared in SCOP 1.73
  
• d2nola1 appears in SCOPe 2.04
  
• d2nola1 appears in SCOPe 2.06
  
• d2nola1 appears in the current release, SCOPe 2.08