SCOPe 2.05: Domain d2noha2: 2noh A:10-135

Lineage for d2noha2 (2noh A:10-135)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
   contains a single copy of this fold

6. Protein 8-oxoguanine glycosylase [55955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)

8. Domain d2noha2: 2noh A:10-135 [138410]
   Other proteins in same PDB: d2noha1
   automated match to d1m3qa2
   protein/DNA complex; complexed with ca

Details for d2noha2

PDB Entry: 2noh, 2.01 Å

PDB Description: structure of catalytically inactive q315a human 8-oxoguanine glycosylase complexed to 8-oxoguanine dna

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2noha2:

Sequence, based on SEQRES records:

>d2noha2 d.129.1.2 (A:10-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
efghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqt
eeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqg
vrllrq

Sequence, based on observed residues (ATOM records):

>d2noha2 d.129.1.2 (A:10-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
efghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqt
eeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrl
lrq

Timeline for d2noha2:

• d2noha2 first appeared in SCOP 1.73
  
• d2noha2 appears in SCOPe 2.04
  
• d2noha2 appears in SCOPe 2.06
  
• d2noha2 appears in the current release, SCOPe 2.08