Lineage for d2noha2 (2noh A:12-135)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538747Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2538859Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
    contains a single copy of this fold
  6. 2538900Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 2538901Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. 2538912Domain d2noha2: 2noh A:12-135 [138410]
    Other proteins in same PDB: d2noha1, d2noha3
    automated match to d1m3qa2
    protein/DNA complex; complexed with ca

Details for d2noha2

PDB Entry: 2noh (more details), 2.01 Å

PDB Description: structure of catalytically inactive q315a human 8-oxoguanine glycosylase complexed to 8-oxoguanine dna
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2noha2:

Sequence, based on SEQRES records: (download)

>d2noha2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records): (download)

>d2noha2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr
q

SCOPe Domain Coordinates for d2noha2:

Click to download the PDB-style file with coordinates for d2noha2.
(The format of our PDB-style files is described here.)

Timeline for d2noha2: