SCOPe 2.05: Domain d2nofa2: 2nof A:9-135

Lineage for d2nofa2 (2nof A:9-135)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families)

5. Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
   contains a single copy of this fold

6. Protein 8-oxoguanine glycosylase [55955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)

8. Domain d2nofa2: 2nof A:9-135 [138408]
   Other proteins in same PDB: d2nofa1
   automated match to d1m3qa2
   protein/DNA complex; complexed with ca

Details for d2nofa2

PDB Entry: 2nof, 2.35 Å

PDB Description: structure of q315f human 8-oxoguanine glycosylase proximal crosslink to 8-oxoguanine dna

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2nofa2:

Sequence, based on SEQRES records:

>d2nofa2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq

Sequence, based on observed residues (ATOM records):

>d2nofa2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Timeline for d2nofa2:

• d2nofa2 first appeared in SCOP 1.73
  
• d2nofa2 appears in SCOPe 2.04
  
• d2nofa2 appears in SCOPe 2.06
  
• d2nofa2 appears in the current release, SCOPe 2.08