Lineage for d2nofa2 (2nof A:9-135)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926122Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 1926234Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
    contains a single copy of this fold
  6. 1926275Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 1926276Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. 1926290Domain d2nofa2: 2nof A:9-135 [138408]
    Other proteins in same PDB: d2nofa1
    automated match to d1m3qa2
    protein/DNA complex; complexed with ca

Details for d2nofa2

PDB Entry: 2nof (more details), 2.35 Å

PDB Description: structure of q315f human 8-oxoguanine glycosylase proximal crosslink to 8-oxoguanine dna
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2nofa2:

Sequence, based on SEQRES records: (download)

>d2nofa2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfq
gvrllrq

Sequence, based on observed residues (ATOM records): (download)

>d2nofa2 d.129.1.2 (A:9-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
sefghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltq
teeqlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

SCOPe Domain Coordinates for d2nofa2:

Click to download the PDB-style file with coordinates for d2nofa2.
(The format of our PDB-style files is described here.)

Timeline for d2nofa2: