Lineage for d2nofa1 (2nof A:136-323)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006171Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006172Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2006213Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)
  6. 2006254Protein 8-oxoguanine glycosylase [48160] (1 species)
  7. 2006255Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries)
  8. 2006269Domain d2nofa1: 2nof A:136-323 [138407]
    Other proteins in same PDB: d2nofa2, d2nofa3
    automated match to d1ebma1
    protein/DNA complex; complexed with ca

Details for d2nofa1

PDB Entry: 2nof (more details), 2.35 Å

PDB Description: structure of q315f human 8-oxoguanine glycosylase proximal crosslink to 8-oxoguanine dna
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2nofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nofa1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaf
avlfsadl

SCOPe Domain Coordinates for d2nofa1:

Click to download the PDB-style file with coordinates for d2nofa1.
(The format of our PDB-style files is described here.)

Timeline for d2nofa1: