| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
| Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) |
| Protein 8-oxoguanine glycosylase [48160] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48161] (24 PDB entries) |
| Domain d2nofa1: 2nof A:136-323 [138407] Other proteins in same PDB: d2nofa2, d2nofa3 automated match to d1ebma1 protein/DNA complex; complexed with ca |
PDB Entry: 2nof (more details), 2.35 Å
SCOPe Domain Sequences for d2nofa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nofa1 a.96.1.3 (A:136-323) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficsscnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkvadcic
lmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaf
avlfsadl
Timeline for d2nofa1: