Lineage for d2noea2 (2noe A:12-135)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733279Superfamily d.129.1: TATA-box binding protein-like [55945] (2 families) (S)
  5. 733391Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (2 proteins)
    contains a single copy of this fold
  6. 733400Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 733401Species Human (Homo sapiens) [TaxId:9606] [55956] (23 PDB entries)
  8. 733410Domain d2noea2: 2noe A:12-135 [138406]
    Other proteins in same PDB: d2noea1
    automatically matched to d1ebma2
    complexed with 8og, ca; mutant

Details for d2noea2

PDB Entry: 2noe (more details), 2.2 Å

PDB Description: structure of catalytically inactive g42a human 8-oxoguanine glycosylase complexed to 8-oxoguanine dna
PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOP Domain Sequences for d2noea2:

Sequence, based on SEQRES records: (download)

>d2noea2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsaqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records): (download)

>d2noea2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsaqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr
q

SCOP Domain Coordinates for d2noea2:

Click to download the PDB-style file with coordinates for d2noea2.
(The format of our PDB-style files is described here.)

Timeline for d2noea2: