Lineage for d2nnua1 (2nnu A:1-200)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678861Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
    complex fold made of bifurcated and coiled beta-sheets
  4. 678862Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (1 family) (S)
  5. 678863Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein)
  6. 678864Protein E2 regulatory, transactivation domain [51334] (3 species)
  7. 678868Species Human papillomavirus type 16 [TaxId:333760] [51336] (2 PDB entries)
  8. 678869Domain d2nnua1: 2nnu A:1-200 [138401]
    automatically matched to d1dtoa_

Details for d2nnua1

PDB Entry: 2nnu (more details), 1.59 Å

PDB Description: Crystal Structure of the Papillomavirus DNA Tethering Complex E2:Brd4
PDB Compounds: (A:) Regulatory protein E2

SCOP Domain Sequences for d2nnua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnua1 b.91.1.1 (A:1-200) E2 regulatory, transactivation domain {Human papillomavirus type 16 [TaxId: 333760]}
metlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvvp
tlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvevq
fdgdicntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekysk
nkvwevhaggqvilcptsvf

SCOP Domain Coordinates for d2nnua1:

Click to download the PDB-style file with coordinates for d2nnua1.
(The format of our PDB-style files is described here.)

Timeline for d2nnua1: