![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily) complex fold made of bifurcated and coiled beta-sheets |
![]() | Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families) ![]() automatically mapped to Pfam PF00508 |
![]() | Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein) |
![]() | Protein E2 regulatory, transactivation domain [51334] (3 species) |
![]() | Species Human papillomavirus type 16 [TaxId:333760] [51336] (2 PDB entries) |
![]() | Domain d2nnua2: 2nnu A:1-200 [138401] Other proteins in same PDB: d2nnua3 automated match to d1dtoa_ protein/DNA complex |
PDB Entry: 2nnu (more details), 1.59 Å
SCOPe Domain Sequences for d2nnua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nnua2 b.91.1.1 (A:1-200) E2 regulatory, transactivation domain {Human papillomavirus type 16 [TaxId: 333760]} metlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvvp tlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvevq fdgdicntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekysk nkvwevhaggqvilcptsvf
Timeline for d2nnua2: