Lineage for d2nnua2 (2nnu A:1-200)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407758Fold b.91: E2 regulatory, transactivation domain [51331] (1 superfamily)
    complex fold made of bifurcated and coiled beta-sheets
  4. 2407759Superfamily b.91.1: E2 regulatory, transactivation domain [51332] (2 families) (S)
    automatically mapped to Pfam PF00508
  5. 2407760Family b.91.1.1: E2 regulatory, transactivation domain [51333] (1 protein)
  6. 2407761Protein E2 regulatory, transactivation domain [51334] (3 species)
  7. 2407765Species Human papillomavirus type 16 [TaxId:333760] [51336] (2 PDB entries)
  8. 2407766Domain d2nnua2: 2nnu A:1-200 [138401]
    Other proteins in same PDB: d2nnua3
    automated match to d1dtoa_
    protein/DNA complex

Details for d2nnua2

PDB Entry: 2nnu (more details), 1.59 Å

PDB Description: Crystal Structure of the Papillomavirus DNA Tethering Complex E2:Brd4
PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d2nnua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nnua2 b.91.1.1 (A:1-200) E2 regulatory, transactivation domain {Human papillomavirus type 16 [TaxId: 333760]}
metlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvvp
tlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvevq
fdgdicntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekysk
nkvwevhaggqvilcptsvf

SCOPe Domain Coordinates for d2nnua2:

Click to download the PDB-style file with coordinates for d2nnua2.
(The format of our PDB-style files is described here.)

Timeline for d2nnua2: