Lineage for d2nn7b1 (2nn7 B:5-260)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808782Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 808783Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 808784Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 808785Protein Carbonic anhydrase [51071] (10 species)
  7. 808791Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (15 PDB entries)
  8. 808800Domain d2nn7b1: 2nn7 B:5-260 [138391]
    automatically matched to d1bzm__
    complexed with dms, m29, zn

Details for d2nn7b1

PDB Entry: 2nn7 (more details), 1.85 Å

PDB Description: structure of inhibitor binding to carbonic anhydrase i
PDB Compounds: (B:) Carbonic anhydrase 1

SCOP Domain Sequences for d2nn7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nn7b1 b.74.1.1 (B:5-260) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

SCOP Domain Coordinates for d2nn7b1:

Click to download the PDB-style file with coordinates for d2nn7b1.
(The format of our PDB-style files is described here.)

Timeline for d2nn7b1: