![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (2 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (1 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (230 PDB entries) |
![]() | Domain d2nmza1: 2nmz A:1-99 [138386] automatically matched to d1s65a_ complexed with roc, so4; mutant |
PDB Entry: 2nmz (more details), 0.97 Å
SCOP Domain Sequences for d2nmza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd qiiieiaghkaigtvlvgptpaniigrnlltqigatlnf
Timeline for d2nmza1: