Lineage for d2nmxb_ (2nmx B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2811459Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2811460Protein Carbonic anhydrase [51071] (10 species)
  7. 2811472Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)
  8. 2811476Domain d2nmxb_: 2nmx B: [138383]
    automated match to d1bzm__
    complexed with m25, na, trs, zn

Details for d2nmxb_

PDB Entry: 2nmx (more details), 1.55 Å

PDB Description: structure of inhibitor binding to carbonic anhydrase i
PDB Compounds: (B:) Carbonic anhydrase 1

SCOPe Domain Sequences for d2nmxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nmxb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

SCOPe Domain Coordinates for d2nmxb_:

Click to download the PDB-style file with coordinates for d2nmxb_.
(The format of our PDB-style files is described here.)

Timeline for d2nmxb_: