Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily) duplication: consists of two similar beta-alpha-beta(4) motifs |
Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families) characteristic metal ion (zinc)-binding motif in the putative active site |
Family d.290.1.3: AF0104-like [143094] (3 proteins) Pfam PF03479; DUF296; PD1 domain; plant- and prokaryote conserved (PPC; see new PDB 2DT4) |
Protein Hypothetical protein STM3071 [143097] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [143098] (1 PDB entry) Uniprot Q8ZM67 6-141 |
Domain d2nmua1: 2nmu A:6-141 [138379] Other proteins in same PDB: d2nmua2 |
PDB Entry: 2nmu (more details), 1.8 Å
SCOPe Domain Sequences for d2nmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nmua1 d.290.1.3 (A:6-141) Hypothetical protein STM3071 {Salmonella typhimurium [TaxId: 90371]} hnastarfyalrllpgqevfsqlhafvqqnqlraawiagctgsltdvalryagqeattsl tgtfevislngtleltgehlhlavsdpygvmlgghmmpgctvrttlelvigelpaltfsr qpcaisgydelhissr
Timeline for d2nmua1: