![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily) duplication: consists of two similar beta-alpha-beta(4) motifs |
![]() | Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (3 families) ![]() characteristic metal ion (zinc)-binding motif in the putative active site |
![]() | Family d.290.1.3: AF0104-like [143094] (2 proteins) Pfam PF03479; DUF296; PD1 domain; plant- and prokaryote conserved (PPC; see new PDB 2DT4) |
![]() | Protein Hypothetical protein STM3071 [143097] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [143098] (2 PDB entries) |
![]() | Domain d2nmua1: 2nmu A:6-141 [138379] |
PDB Entry: 2nmu (more details), 1.8 Å
SCOP Domain Sequences for d2nmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nmua1 d.290.1.3 (A:6-141) Hypothetical protein STM3071 {Salmonella typhimurium [TaxId: 602]} hnastarfyalrllpgqevfsqlhafvqqnqlraawiagctgsltdvalryagqeattsl tgtfevislngtleltgehlhlavsdpygvmlgghmmpgctvrttlelvigelpaltfsr qpcaisgydelhissr
Timeline for d2nmua1: