SCOPe 2.08: Domain d2nmua1: 2nmu A:6-141

Lineage for d2nmua1 (2nmu A:6-141)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.290: AF0104/ALDC/Ptd012-like [117855] (1 superfamily)
   duplication: consists of two similar beta-alpha-beta(4) motifs

4. Superfamily d.290.1: AF0104/ALDC/Ptd012-like [117856] (4 families)
   characteristic metal ion (zinc)-binding motif in the putative active site

5. Family d.290.1.3: AF0104-like [143094] (3 proteins)
   Pfam PF03479; DUF296; PD1 domain; plant- and prokaryote conserved (PPC; see new PDB 2DT4)

6. Protein Hypothetical protein STM3071 [143097] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [143098] (1 PDB entry)
   Uniprot Q8ZM67 6-141

8. Domain d2nmua1: 2nmu A:6-141 [138379]
   Other proteins in same PDB: d2nmua2

Details for d2nmua1

PDB Entry: 2nmu, 1.8 Å

PDB Description: Crystal structure of the hypothetical protein from Salmonella typhimurium LT2. Northeast Structural Genomics Consortium target StR127.

PDB Compounds: (A:) Putative DNA-binding protein

SCOPe Domain Sequences for d2nmua1:

Sequence; same for both SEQRES and ATOM records:

>d2nmua1 d.290.1.3 (A:6-141) Hypothetical protein STM3071 {Salmonella typhimurium [TaxId: 90371]}
hnastarfyalrllpgqevfsqlhafvqqnqlraawiagctgsltdvalryagqeattsl
tgtfevislngtleltgehlhlavsdpygvmlgghmmpgctvrttlelvigelpaltfsr
qpcaisgydelhissr

Timeline for d2nmua1:

• d2nmua1 first appeared in SCOP 1.73
  
• d2nmua1 appears in SCOPe 2.07