![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.322: PHP14-like [143723] (1 superfamily) beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest |
![]() | Superfamily d.322.1: PHP14-like [143724] (2 families) ![]() |
![]() | Family d.322.1.1: Janus/Ocnus [143725] (1 protein) Pfam PF05005 |
![]() | Protein Phosphohistidine phosphatase 1, PHP14 [143726] (1 species) Janus-A homolog |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143727] (5 PDB entries) Uniprot Q9NRX4 1-125! Uniprot Q9NRX4 2-121! Uniprot Q9NRX4 5-122 |
![]() | Domain d2nmmb2: 2nmm B:1-121 [138373] Other proteins in same PDB: d2nmmb3 automated match to d2ai6a1 complexed with so4 |
PDB Entry: 2nmm (more details), 2.7 Å
SCOPe Domain Sequences for d2nmmb2:
Sequence, based on SEQRES records: (download)
>d2nmmb2 d.322.1.1 (B:1-121) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]} mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw a
>d2nmmb2 d.322.1.1 (B:1-121) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]} mavadlalipdvdidsdgvfkyvlirvhsaskeivrgykwaeyhadiydkvsgdmqkqgc dceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtwa
Timeline for d2nmmb2: