Lineage for d2nmmb2 (2nmm B:1-121)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010920Fold d.322: PHP14-like [143723] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest
  4. 3010921Superfamily d.322.1: PHP14-like [143724] (2 families) (S)
  5. 3010922Family d.322.1.1: Janus/Ocnus [143725] (1 protein)
    Pfam PF05005
  6. 3010923Protein Phosphohistidine phosphatase 1, PHP14 [143726] (1 species)
    Janus-A homolog
  7. 3010924Species Human (Homo sapiens) [TaxId:9606] [143727] (5 PDB entries)
    Uniprot Q9NRX4 1-125! Uniprot Q9NRX4 2-121! Uniprot Q9NRX4 5-122
  8. 3010927Domain d2nmmb2: 2nmm B:1-121 [138373]
    Other proteins in same PDB: d2nmmb3
    automated match to d2ai6a1
    complexed with so4

Details for d2nmmb2

PDB Entry: 2nmm (more details), 2.7 Å

PDB Description: crystal structure of human phosphohistidine phosphatase. northeast structural genomics consortium target hr1409
PDB Compounds: (B:) 14 kDa phosphohistidine phosphatase

SCOPe Domain Sequences for d2nmmb2:

Sequence, based on SEQRES records: (download)

>d2nmmb2 d.322.1.1 (B:1-121) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv
sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw
a

Sequence, based on observed residues (ATOM records): (download)

>d2nmmb2 d.322.1.1 (B:1-121) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
mavadlalipdvdidsdgvfkyvlirvhsaskeivrgykwaeyhadiydkvsgdmqkqgc
dceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtwa

SCOPe Domain Coordinates for d2nmmb2:

Click to download the PDB-style file with coordinates for d2nmmb2.
(The format of our PDB-style files is described here.)

Timeline for d2nmmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2nmmb3