SCOPe 2.08: Domain d2nmmb2: 2nmm B:1-121

Lineage for d2nmmb2 (2nmm B:1-121)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.322: PHP14-like [143723] (1 superfamily)
   beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest

4. Superfamily d.322.1: PHP14-like [143724] (2 families)

5. Family d.322.1.1: Janus/Ocnus [143725] (1 protein)
   Pfam PF05005

6. Protein Phosphohistidine phosphatase 1, PHP14 [143726] (1 species)
   Janus-A homolog

7. Species Human (Homo sapiens) [TaxId:9606] [143727] (5 PDB entries)
   Uniprot Q9NRX4 1-125! Uniprot Q9NRX4 2-121! Uniprot Q9NRX4 5-122

8. Domain d2nmmb2: 2nmm B:1-121 [138373]
   Other proteins in same PDB: d2nmmb3
   automated match to d2ai6a1
   complexed with so4

Details for d2nmmb2

PDB Entry: 2nmm, 2.7 Å

PDB Description: crystal structure of human phosphohistidine phosphatase. northeast structural genomics consortium target hr1409

PDB Compounds: (B:) 14 kDa phosphohistidine phosphatase

SCOPe Domain Sequences for d2nmmb2:

Sequence, based on SEQRES records:

>d2nmmb2 d.322.1.1 (B:1-121) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv
sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw
a

Sequence, based on observed residues (ATOM records):

>d2nmmb2 d.322.1.1 (B:1-121) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
mavadlalipdvdidsdgvfkyvlirvhsaskeivrgykwaeyhadiydkvsgdmqkqgc
dceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtwa

Timeline for d2nmmb2:

• d2nmmb2 first appeared in SCOP 1.73, called d2nmmb1
  
• d2nmmb2 appears in SCOPe 2.07