Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.330: ERH-like [143874] (1 superfamily) beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10 |
Superfamily d.330.1: ERH-like [143875] (1 family) automatically mapped to Pfam PF01133 |
Family d.330.1.1: ERH-like [143876] (2 proteins) Pfam PF01133 |
Protein Enhancer of rudimentary homolog, ERH [143877] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [143878] (5 PDB entries) Uniprot P84089 1-104! Uniprot P84090 2-101 also includes 100% identical human protein P84090 (1W9G) |
Domain d2nmla1: 2nml A:2-101 [138371] human protein, identical to mouse sequence |
PDB Entry: 2nml (more details), 1.55 Å
SCOPe Domain Sequences for d2nmla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nmla1 d.330.1.1 (A:2-101) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]} shtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdfi ddladlsclvyradtqtyqpynkdwikekiyvllrrqaqq
Timeline for d2nmla1: